PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00138.140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 952aa    MW: 106087 Da    PI: 5.5707
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00138.140genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.9e-33723777155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWtpeLH++Fveav++LGGse+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  Jcr4S00138.140 723 KTRMRWTPELHDAFVEAVNKLGGSERATPKGVLKLMNVEGLTIYHVKSHLQKYRT 777
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS51580173.0544531IPR025776Histone-lysine N-methyltransferase SUVR4/SUVR1/SUVR2
Gene3DG3DSA:2.170.270.102.2E-63177272No hitNo description
SMARTSM004681.3E-14184321IPR007728Pre-SET domain
PfamPF050331.0E-12187329IPR007728Pre-SET domain
SuperFamilySSF821997.36E-58194489No hitNo description
PROSITE profilePS508678.647240334IPR007728Pre-SET domain
Gene3DG3DSA:2.170.270.102.2E-63307490No hitNo description
SMARTSM003171.3E-24337472IPR001214SET domain
PROSITE profilePS5028014.229337466IPR001214SET domain
PfamPF008561.5E-11349466IPR001214SET domain
PROSITE profilePS508688.266477493IPR003616Post-SET domain
PROSITE profilePS5129410.751720780IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-30722779IPR009057Homeodomain-like
SuperFamilySSF466891.79E-17722777IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24723777IPR006447Myb domain, plants
PfamPF002496.1E-10725776IPR001005SANT/Myb domain
PfamPF143793.4E-24808855IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0034968Biological Processhistone lysine methylation
GO:0005730Cellular Componentnucleolus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0018024Molecular Functionhistone-lysine N-methyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 952 aa     Download sequence    Send to blast
PCLDSLLIFE GFSTGNKALS CLTSQYDASC SGSTESTLCE SNFAIASSTL QQVKILLNCD  60
FAVQQSNFQV PEINAVLKTL EDRYLRMHKL VSPQFSVMKL LKDFCDLYLE LGTVSSNWPV  120
ADNSPVVRKV GDPFHSVGSN RKASSDQALK GKASKPCRFS NFHNLVNVQQ GTTAIDVKKS  180
IKKLNDITKG SENVQISLIA EVGNDDIPKF TYMPQNIIYQ NACMQISLAR IADEDCCSGC  240
SGDCLSHQLP CACARETRGE FAYTQQGLLT QEFLRESVST KRDPHIKNFV FCQEYCPLER  300
YKKCKGHLVR KFIKECWMKC GCDMNCGNRI IQRGITCNLQ VFLTHEDKGW GVRTLNDLPE  360
GTFVCEYVGE ILTNTELYDR NMQNSGSDRH TYPVTLDADW GSERVLRDDE ALCLDATFSG  420
NVARCNDANL IDIPVQVETP DRHYYHLAFF TTREVRAFEE LTWDYGIDFD DHDHPIKAFQ  480
CCCGSASCRD LKGNNYYVVL AQGSCAKQLT SNVSIFSKRE LTKGPVSQQA SSLGPNIGTT  540
GHLSSSSLRF LNQVHSSFSS PRRVQSQNYP FIAKSSSDGG PLLGAPTGSS HSDVQPTALM  600
TDPEENNNMS WSIDPLHDLL DFPENIPVQN GQVESNIGVI SSEDISKKAD WQDWADQLIS  660
VDDDLEPNWS EILNDANATD AKQKVLKSPS GISVQPQIHQ HQVVSSGETY TAANPTSAAP  720
AAKTRMRWTP ELHDAFVEAV NKLGGSERAT PKGVLKLMNV EGLTIYHVKS HLQKYRTARY  780
KPESSEGSSE KKLNPIDEMK SLDLKTSMGI TEALRLQMEV QKRLHEQLEI QRNLQLRIEE  840
QGRYLQMMFE KQRKMEEEKS KDSSSSPVDD PSLPQSNLVQ QPGNNKSEVS QQDNAKTGFD  900
GNDAGSALEE SFQSVSKKQK VQENKTCKGF DPEDNECSPA SAKRPRTDET EL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3fpd_B6e-321864898259Histone-lysine N-methyltransferase, H3 lysine
3fpd_A6e-321864898259Histone-lysine N-methyltransferase, H3 lysine
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA10G30833.10.0(Glycine max)
STRINGGLYMA20G37135.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF451222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.37e-87G2-like family protein